Women As Food

---

frenchchickenravenandthepeachwefancygeoff tenantyesfilters

---

LIVE

Safronova Antoneena Federovna, Odessa Food Trust box and cover, ca. 1922. Printed paper on boardCoop

kiranxrys:          reasons to live according to Jadzia Dax: food, sleep & womenS04E23 ’To the D

ultrafacts:Excess food is a serious issue in the US. After paper, food scraps are the nation’s secon

#Repost @recipesforselflove (@get_repost)・・・Women’s relationship with food is notoriously comp

“You didn’t touch on anything DID YOU?”Cat won’t share it’s food. Digital colors and traditional ink

atomicdisease:The Women of Fried Green Tomatoes

girlkillsgod:“Holy Feast and Holy Fast: The Religious Significance of Food to Medieval Women” by Car

hauntedbystorytelling:Three young women eat spaghetti on inflatable mattresses at Lake of Capri, 193

filmgifs:FOOD SYMBOLISM IN FILMMoonlight (2016)Parasite (2019)Little Women (2019)Get Out (2017)Inglo

labillustration:Inktober 4: Orc butcher! Featuring lack of perspective and creatures I made up!This

lookingformybimbo:Boobs and food. This bimbo knows how to please.She spent her work break on this so

misogynistowner:Real women cook.She should definitely be focusing on not burning the food right now.

The Ministry of Food worked onincreasing the calcium intake of children and pregnant women duringWor

#Repost @barrio_sustainability (@get_repost)・・・Love this story about @sanajaverikadrifrom @civileats

Dark Chocolate & granola covered blackberries. (traduccion abajo)Ingredients: cacoa semi-sweet c

Lamb Chops & Spicy-Sweet Potato & dried Cranberry Waffle. Certified post workout muscle food

Muscle Muffin! This is better than McDonald’s and #uoeno! Start your morning off right and tak

Surf and Turf Muscle Kabobs! Swordfish steak & flank steak with cherry tomatoes and yellow bell

Drew this while contemplating Asian American identity and how it greatly differs from Asian identity

Women #love a #man who can cook. #cook #food #chef #spanish

BBQ turkey & sweet potato sliders with spinach & arugula mix and blueberries. Boom. Ingredi

PURRITO CAT T-Shirt - ON SALE NOW—Only $12.63 (40% OFF) with code GREATDEALZAZ—Offer ends Sunday, Ap

Healthy Pancakes that taste Amazing! nutritionbeast.com/2016/09/bobs-red-mill-high-protein-ch

wvfootfetish: modelodette:Mmm, vacation tastes good! #feet #foot #beaches #travel #wine #food #foodi

Prev PageNext Page