TumblrPics.com
HOME
DMCA
Live
Gallery
Viewer
Potc Rp
farklematthews
hot-queenainsleigh
spainkitty-mishassweetestkittl
dorio666
clubpatron
LIVE
kpfun:PIRATES OF THE CARIBBEAN: DEAD MAN’S CHEST (2006) dir. Gore Verbinski
(o^▽^o)
Pirates of The Caribbean vs Ao3 tags Part 1/??
ohaldir:Pirates of the Caribbean Meme: [2/5] Characters: William Turner“It wasn’t your blood t
williamturnerdaily:Will Turner, do you take me to be your wife? In sickness and in health… with heal
winterswake:PIRATES OF THE CARIBBEAN:DEAD MAN’S CHEST (2006) dir. Gore Verbinski
elizabthturner:potc meme: [1/3] relationships ☠ will and elizabethelizabeth, i should have told you
creganstarks:If only you had a heart to give…
mockingjaykatniss2:potc meme | five characters ► [4/5] james norrington↳ My story? It’s exactly th
Now it’s become Jack Sparrow day!
Well, I won’t be making that mistake again. —Pirates of the Caribbean: the Curse of the Black Pearl,
I should have told you every day from the moment I met you…I love you.
natasharomonoff:Pirates of the Caribbean: The Curse of the Black Pearl (2003)dir. Gore Verbinski
zombeesknees:mockingjaykatniss2:Will and Elizabeth + looks#high. fucking. romance. #like writing in
elizabethswcnn:follower celebration: @elizabcthturner asked potc or star warsYou are without a doubt
elizabthturner:potc meme: [4/5] characters ☠ tia dalmathere’s an evil on these seas that even the mo
mockingjaykatniss2:potc meme | five characters ► [3/5] captainjack sparrow↳ Son… I’m Captain Jack
Cold nights make me think of the heated Pirate sequence in World of Color, which I miss with every o
daisieridley:williamturnerdaily:You forget your place, Turner.P
kakastravakaianapoda:Potc + tumblr text postspart 4/?part 1 part 2 part 3
Most Feared in the Seven Seas Pirate Lord Astrid, Soon-To-Be-Pirate-King, was expecting Prince Hiccu
bennskywalker:keep a weather eye on the horizon.
castiel-counts-deans-freckles:This is like a round of cards against humanity
williamturnerdaily:(˶ •́ ~ •̀ ˶)
Prev Page
Next Page