Mystery Gang
nadiaaboulhosnannette schwarzdaddyslittlekittenikleyveynsfwwarlock
Webcam Model (-Imsam-) is live.Free join now!
LIVE
ehretria:mystery inc. meets social media. the gang is taking a year off from school and they are on
ehretria:mystery inc. meets social media. the gang is taking a year off from school and they are on
kobochat:WELL GANG IT LOOKS LIKE WE’VE GOT ANOTHER MYSTERY ON OUR HANDS
kobochat:WELL GANG IT LOOKS LIKE WE’VE GOT ANOTHER MYSTERY ON OUR HANDS
demizouie:Try and tell me this crew wouldn’t make the coolest scooby doo style mystery gang that fig
demizouie:Try and tell me this crew wouldn’t make the coolest scooby doo style mystery gang that fig
niklausxcaroline:mystery incorporated members = the gang (insp.)what’s new scooby-doo? we’re comin’
niklausxcaroline:mystery incorporated members = the gang (insp.)what’s new scooby-doo? we’re comin’
Scooby dooby dooooo & crew
Scooby dooby dooooo & crew
jadeyarts:felt like drawing the strangetown teens as mystery inc (aka, the gang) from scooby do
jadeyarts:felt like drawing the strangetown teens as mystery inc (aka, the gang) from scooby do
scoobydoomistakes: The gang’s chilling at the malt shop, as per usual. The Mystery Machine sit
scoobydoomistakes: The gang’s chilling at the malt shop, as per usual. The Mystery Machine sit
Best thing to do is simply keep wearing your outfit and stay as a slutty latex girl 24/7. That way w
Best thing to do is simply keep wearing your outfit and stay as a slutty latex girl 24/7. That way w
Hand painted custom kids shoes, Scooby doo and the whole gang!Visit our store to see what we have to
Hand painted custom kids shoes, Scooby doo and the whole gang!Visit our store to see what we have to
solopschism: “come on gang let’s go solve a mystery or some shit” greed
solopschism: “come on gang let’s go solve a mystery or some shit” greed
Had tons of fun with my Mystery Skulls gang last weekend Lewis: @stormagedoomArthur: @grayfoxar
Had tons of fun with my Mystery Skulls gang last weekend Lewis: @stormagedoomArthur: @grayfoxar
magikatscomic:The Mystery of the Moon, Page 106So proud of this gang! Who was your favorite in this
magikatscomic:The Mystery of the Moon, Page 106So proud of this gang! Who was your favorite in this
The Mystery of the Moon, Page 115I love this split panel! What do you think the Magikats! gang is go
The Mystery of the Moon, Page 115I love this split panel! What do you think the Magikats! gang is go
The Mystery of the Moon, Page 106So proud of this gang! Who was your favorite in this last sequence?
The Mystery of the Moon, Page 106So proud of this gang! Who was your favorite in this last sequence?
Road trip with the gang.
Road trip with the gang.
working on drawing bodies/clothes! she was always my favorite member of mystery inc.
working on drawing bodies/clothes! she was always my favorite member of mystery inc.
The gang is all here to wish you a happy new years to all of you!And to a hopeful new start in the y
The gang is all here to wish you a happy new years to all of you!And to a hopeful new start in the y
soldrawss:“Looks like we’ve got another mystery on our hands, gang.”
soldrawss:“Looks like we’ve got another mystery on our hands, gang.”
soldrawss: “Looks like we’ve got another mystery on our hands, gang.”
soldrawss: “Looks like we’ve got another mystery on our hands, gang.”
soldrawss: “Looks like we’ve got another mystery on our hands, gang.”
soldrawss: “Looks like we’ve got another mystery on our hands, gang.”
soldrawss: “Looks like we’ve got another mystery on our hands, gang.”
soldrawss: “Looks like we’ve got another mystery on our hands, gang.”
soldrawss: “Looks like we’ve got another mystery on our hands, gang.”
soldrawss: “Looks like we’ve got another mystery on our hands, gang.”
soldrawss:“Looks like we’ve got another mystery on our hands, gang.”
soldrawss:“Looks like we’ve got another mystery on our hands, gang.”
ghosttrickgirl:daphne’s room velma’s room
ghosttrickgirl:daphne’s room velma’s room
Prev PageNext Page