Long Chain

---

aggretsuko fanartsnackiiesnicenakedmenreptiliaalvins-hot-juicebox

---

LIVE

primagiedi:longlivelaflame:Travis Scott giving his chain to his younger brother I love him

p1np01nt:dryeguy:tehrogue:tokkil:heavenfell-mun:frozenhaart:deleriousfromcoffee:heavenfell-mun:shitp

faerendipitous:clusterfunky:strawberry-sprite:but-i-have-brought-their-pyre:determinedrevolutionary:

pileofknives:sapper-in-the-wire:paintmeahero:Check out the rest of this (very long) tweet chain here

Antique Victorian LOCKET Black Mourning Jewelry Watch CHAIN Tassel, Whitby Jet Gutta Percha Bog Oak

pileofknives:sapper-in-the-wire:paintmeahero:Check out the rest of this (very long) tweet chain here

i’m an urban tigress 

ART DECO Crystal Rainbow WATERMELON Glass Necklace Pendant Star Motif 24" Chain c.1920s

Vintage STERLING Silver OWL Necklace Bird Pendant Signed Sterling 22 Inch Long CHAIN c.1970s

he is a MASTER with his long tonuge.  His videos are OFF THE CHAIN!

longbootshighsneaks:On the Chain Muzzled - cute pleading eyes

cervixplay: Insertion a metal chain very long full into uterus. Extreme scene of the video insertin

cervixplay: Extreme cervix playing pulling a very long metal chain from her uterus.  Amazing scene

Antique WATCH Chain Signed JFSS Long Mens Pocketwatch Chains Thick Gold Filled SCROLL Curb Links Hoo

W&H Co Signed Victorian LOCKET Necklace HEART Gold Filled, Diamond Paste, Insert Frames, Cellulo

ROCOCO Victorian Heart 10K Diamond LOCKET Necklace Solid Gold Long 20" CHAIN, Repousse Scroll A

pastrami-golem:jkszgz:carnival-phantasm:dreshdae:nights-in-white-satin:surfcommiesmustdie:mikeneedsa

(via Art Deco STERLING Watch CHAIN Muff Guard Sautoir Necklace | Etsy)

Antique Victorian CUT STEEL Tassel Necklace Long Paperclip CHAIN c.1870s, Gift for Her

Sansa inspired winter outfits by withfashionandblood featuring chain necklacesTopshop long sleeve dr

Versace

browngirl:does this body chain look weird with this shirtshould I wear like a long necklace with a q

thepalestineyoudontknow:About than 7,000 Palestinians gathered in the longest reading human chain ar

Trendy Bag for FW21: 90′s grungy chain handle bag.Acne Studios, Fendi, Longchamp, Marques&rsqu

Prev PageNext Page