Earth Sciences
oursocalledkinkylifestephaniesimsdiamondsintheskycybuggingthe-little-house-of-morons
Webcam Model (_Shimmerlyn_) is live.Free join now!
LIVE
Electron microscope image of diatomaceous earth
Electron microscope image of diatomaceous earth
LEAD Energy: ReceptivePlanet: SaturnElement: EarthAssociated Herbs: Rose, Nettle, Rue, CuminPowers:
LEAD Energy: ReceptivePlanet: SaturnElement: EarthAssociated Herbs: Rose, Nettle, Rue, CuminPowers:
spacetimewithstuartgary: Earth’s atmosphere: new results from the International Space Station With
spacetimewithstuartgary: Earth’s atmosphere: new results from the International Space Station With
LEAD Energy: ReceptivePlanet: SaturnElement: EarthAssociated Herbs: Rose, Nettle, Rue, CuminPowers:
LEAD Energy: ReceptivePlanet: SaturnElement: EarthAssociated Herbs: Rose, Nettle, Rue, CuminPowers:
FOSSILS FRIDAY Discovery of Fossilized Protein in a Dinosaur bone. The researchers at the University
FOSSILS FRIDAY Discovery of Fossilized Protein in a Dinosaur bone. The researchers at the University
Top Shot: The Perfect Storm Top Shot features the photo with the most votes from the previous day&r
Top Shot: The Perfect Storm Top Shot features the photo with the most votes from the previous day&r
Top Shot: Facing the Giant Top Shot features the photo with the most votes from the previous day&rs
Top Shot: Facing the Giant Top Shot features the photo with the most votes from the previous day&rs
Wave rock around base of the Uluru monolith in Central Australia. An example of erosion-driven sculp
Wave rock around base of the Uluru monolith in Central Australia. An example of erosion-driven sculp
#Tuesday trivia Edition#1
#Tuesday trivia Edition#1
Joides Resolution does it again This ship is one of the unsung heroes of the Earth Sciences, drillin
Joides Resolution does it again This ship is one of the unsung heroes of the Earth Sciences, drillin
Geotricks uncover Stonehenge secretsThe tools of the Earth sciences are of great service to archaeol
Geotricks uncover Stonehenge secretsThe tools of the Earth sciences are of great service to archaeol
MENTORING MONDAY #Edition2 #wonderfulweek
MENTORING MONDAY #Edition2 #wonderfulweek
Prev PageNext Page